PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10009037
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 247aa    MW: 27525.8 Da    PI: 6.3588
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10009037genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.96.4e-202269148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd ll ++++q+G g+W++ a++ g++Rt+k+c++rw++yl
      Lus10009037 22 RGPWTQEEDNLLRRYIHQHGDGRWNSLAKRAGLRRTGKSCRLRWLNYL 69
                     89********************************************97 PP

2Myb_DNA-binding52.98.6e-1775118146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T++E++l++d++ ++G++ W++Ia++++ gRt++++k++w++
      Lus10009037  75 RGNLTPQEQLLILDLHSKWGNR-WSKIAQYLP-GRTDNEIKNYWRT 118
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.1561773IPR017930Myb domain
SuperFamilySSF466891.39E-3020116IPR009057Homeodomain-like
SMARTSM007176.4E-172171IPR001005SANT/Myb domain
PfamPF002496.2E-192269IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-242376IPR009057Homeodomain-like
CDDcd001676.62E-142469No hitNo description
PROSITE profilePS5129419.94774124IPR017930Myb domain
SMARTSM007171.1E-1474122IPR001005SANT/Myb domain
PfamPF002491.8E-1575118IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.7E-2377123IPR009057Homeodomain-like
CDDcd001672.15E-1179118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MSCGSSSPSS SSDGSGGDKL RRGPWTQEED NLLRRYIHQH GDGRWNSLAK RAGLRRTGKS  60
CRLRWLNYLN PEVKRGNLTP QEQLLILDLH SKWGNRWSKI AQYLPGRTDN EIKNYWRTRV  120
QKEARNLNVD PNGDVFSDII KCFFMPRLVE KIERSSSIPS SSAVAAVSGG KSLETVSASA  180
TDYVPFSGDG PLELMHPSPL QPEIQSGGCY DLDIVLGDVD GGLHVAEADW VGGYEMWDNM  240
YELYDC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-262012425128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007209375.14e-79hypothetical protein PRUPE_ppa008877mg
RefseqXP_008240255.15e-79PREDICTED: transcription factor MYB108-like
SwissprotQ9LDE17e-59MY108_ARATH; Transcription factor MYB108
TrEMBLM5WA274e-79M5WA27_PRUPE; Uncharacterized protein
STRINGPOPTR_0012s05200.13e-75(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16393494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68320.12e-73myb domain protein 62